PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010908127.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family NAC
Protein Properties Length: 356aa    MW: 40206.5 Da    PI: 7.4948
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010908127.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1622.2e-50111401128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvka...eekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 
                     +ppGfrFhPt+eel+++yLkkkv+ +k++l +vi+++d++k+ePwd++ k+k     ++ewyfFs++dkky+tg+r+nrat++g+Wkatg+dk +
  XP_010908127.1  11 VPPGFRFHPTEEELLNYYLKKKVACQKIDL-DVIRDIDLNKIEPWDIQVKCKIgsaPQNEWYFFSHQDKKYPTGTRTNRATAAGFWKATGRDKVI 104
                     69****************************.9***************954433223556************************************ PP

             NAM  93 lskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                     ++++ + +g++ktLvfykgrap+g k+dW+m eyrl
  XP_010908127.1 105 YAASFKRIGMRKTLVFYKGRAPHGLKSDWIMYEYRL 140
                     ***99*****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.01E-544173IPR003441NAC domain
PROSITE profilePS5100554.21911173IPR003441NAC domain
PfamPF023654.8E-2612140IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 356 aa     Download sequence    Send to blast
MSILVVGQSR VPPGFRFHPT EEELLNYYLK KKVACQKIDL DVIRDIDLNK IEPWDIQVKC  60
KIGSAPQNEW YFFSHQDKKY PTGTRTNRAT AAGFWKATGR DKVIYAASFK RIGMRKTLVF  120
YKGRAPHGLK SDWIMYEYRL DDHLYTKSSS NASSPAGETA QEEGWVVCRV FKKRNCQTSS  180
TASDAKAQTL HYSCNDEALD QILQGLGRSC KQESNAIVSI DNMKDNKNYP RPIETSLGSM  240
KLLALESPIL PPLPDFAPEV EPADAIMDMD WPSLNYENVF HSTGSYLEAQ KQLPYIDDPS  300
FGLISSNGLF SNSQDYRHGV GDPWTFVRSV SSSSDHTCHI LHPCCNITTQ QLAKNI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A4e-461117515170Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010908127.10.0PREDICTED: NAC domain-containing protein 43-like
SwissprotQ84WP61e-102NAC43_ARATH; NAC domain-containing protein 43
TrEMBLM0SDZ01e-116M0SDZ0_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr3P12230_0011e-116(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP159738112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46770.11e-92NAC family protein